CJC-1295 / Ipamorelin
Peptide Blend (GHRH Analog + GH Secretagogue)
A research blend of a GHRH analog and a selective ghrelin-receptor agonist, studied together for growth-hormone signalling.
From $187.50 USD
Available strengths
- 10mg — $187.50
Molecular profile
- CAS Number
- 863288-34-0 / 170851-70-4
- Molecular Weight
- 3367.90 / 711.85 g/mol
- Molecular Formula
- C152H252N44O42 / C38H49N9O5
- Amino Acids
- 29 / 5
- Sequence
- CJC-1295: YDAIFTQSYRKVLAQLSARKLLQDILSR-NH2 (4 substitutions vs native GHRH); Ipamorelin: Aib-His-D-2Nal-D-Phe-Lys-NH2
- Type
- Peptide Blend (GHRH Analog + GH Secretagogue)
PubChem CID 91976842 / 9832162
For research use only. Not for human or veterinary use.